General Information

  • ID:  hor006110
  • Uniprot ID:  P06307
  • Protein name:  Cholecystokinin-58 desnonopeptide
  • Gene name:  CCK
  • Organism:  Homo sapiens (Human)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with CCK include Cholecystitis and Biliary Dyskinesia.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISD
  • Length:  49
  • Propeptide:  MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  • Signal peptide:  MNSGVCLCVLMAVLAAGALT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR, CCKAR
  • Target Unid:  P32239, P32238
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06307-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006110_AF2.pdbhor006110_ESM.pdb

Physical Information

Mass: 629951 Formula: C230H387N79O72S
Absent amino acids: CFW Common amino acids: RS
pI: 11.41 Basic residues: 10
Polar residues: 13 Hydrophobic residues: 15
Hydrophobicity: -72.65 Boman Index: -13980
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.71
Instability Index: 4406.73 Extinction Coefficient cystines: 1490
Absorbance 280nm: 31.04

Literature

  • PubMed ID:  3856870
  • Title:  Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  9371719
  • Title:  Cleavage of arginyl-arginine and lysyl-arginine from the C-terminus of pro-hormone peptides by human germinal angiotensin I-converting enzyme (ACE) and the C-domain of human somatic ACE.
  • PubMed ID:  10336644
  • Title:  Hydrolysis by somatic angiotensin-I converting enzyme of basic dipeptides from a cholecystokinin/gastrin and a LH-RH peptide extended at the C-terminus with gly-Arg/Lys-arg, but not from diarginyl insulin.
  • PubMed ID:  11076522
  • Title:  Role of tyrosine sulfation and serine phosphorylation in the processing of procholecystokinin to amidated cholecystokinin and its secretion in transfected AtT-20 cells.